Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P25153
Gene Names: UbcD6
Organism: Drosophila melanogaster (Fruit fly)
AA Sequence: MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID
Expression Region: 1-151aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 19.2 kDa
Alternative Name(s): Ubiquitin carrier proteinUbiquitin-protein ligase
Relevance: Catalyzes the covalent attachment of ubiquitin to other proteins. Required for postreplication repair of UV-damaged DNA.
Reference: Dhr6, a Drosophila homolog of the yeast DNA-repair gene RAD6.Koken M.H.M., Reynolds P., Bootsma D., Hoeijmakers J.H.J., Prakash S., Prakash L.Proc. Natl. Acad. Sci. U.S.A. 88:3832-3836(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.