Gene Bio Systems
Recombinant Drosophila melanogaster Transmembrane protein 70 homolog, mitochondrial(CG7506)
Recombinant Drosophila melanogaster Transmembrane protein 70 homolog, mitochondrial(CG7506)
SKU:CSB-CF856836DLU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Drosophila melanogaster (Fruit fly)
Uniprot NO.:Q95SS8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SDDALQRIYYGTLAPRMKMVKFFSLSTSLAGLAAQPILLEQGMKIGGTGMAVFLCTVGGF FTFVTPLLLHFITKKYVTELHYNPLTEEYTATTISLLLQKIKTTFRPNDVVVPEVPGMFT SFLVNKRPLFVDPALFDDPEHYVKIMGYDKPIDFKLDLTPNPEKSKTSEEKQ
Protein Names:Recommended name: Transmembrane protein 70 homolog, mitochondrial
Gene Names:ORF Names:CG7506
Expression Region:65-236
Sequence Info:full length protein
