Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila melanogaster Signal peptidase complex subunit 1(Spase12)

Recombinant Drosophila melanogaster Signal peptidase complex subunit 1(Spase12)

SKU:CSB-CF893724DLU

Regular price $1,797.50 CAD
Regular price Sale price $1,797.50 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:Q9VAL0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLDIQTHMDFAGQGKAERWSRFIITFFGIVGLVYGAFVQQFSQTVYILGAGFVLSSLITI PPWPLYRRNALKWQKPIDTDAKSSSSESGDEGKKKKKQ

Protein Names:Recommended name: Signal peptidase complex subunit 1 EC= 3.4.-.- Alternative name(s): Microsomal signal peptidase 12 kDa subunit Short name= SPase 12 kDa subunit

Gene Names:Name:Spase12 ORF Names:CG11500

Expression Region:1-98

Sequence Info:full length protein

View full details