Skip to product information
1 of 1

GeneBio Systems

Recombinant Drosophila melanogaster Protein nanos (nos), partial

Recombinant Drosophila melanogaster Protein nanos (nos), partial

SKU:P25724

Regular price $982.60 CAD
Regular price Sale price $982.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P25724

Gene Names: nos

Alternative Name(s):

Abbreviation: Recombinant Drosophila melanogaster nos protein, partial

Organism: Drosophila melanogaster (Fruit fly)

Source: E.coli

Expression Region: 211-401aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-KSI-tagged

Target Protein Sequence: LGRNPAQLQTNGGNLMPIPLATHWLNNYREHLNNVWRNMSYIPAAPNTMGLQAQTAATVSTNLGVGMGLGLPVQGEQLRGASNSSNNNNNNNKVYKRYNSKAKEISRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCPKKPIITMEDAIKAESFRLAKSSYYKQQMKV

MW: 36.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Maternal RNA-binding protein that is required for germ cells proliferation and self-renewal. Acts by forming a complex with pum and brat that regulates translation and mRNA stability. The complex binds to the Nanos Response Element (NRE), a 16 bp sequence in the hb mRNA 3'-UTR and prevents its translation. Controls posterior development. Rescuing factor for the abdominal defect of posterior group mutants. The other posterior group genes are not required for nanos function but rather play a role in localization or distribution of nanos protein.

Reference:

Function:

View full details