Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Drosophila melanogaster (Fruit fly)
Uniprot NO.:O77286
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSASADSLGAAAALDKYGDEDIFSLLIRYGLYVGALFQFVCISAAVLMENNPDGQSNPES GEVTEREGEPVRTRLHKIRKLEKKKRR
Protein Names:Recommended name: Protein anon-73B1
Gene Names:Name:anon-73B1 Synonyms:anon73B1 ORF Names:CG4101
Expression Region:1-87
Sequence Info:full length protein