Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila melanogaster Probable mitochondrial import inner membrane translocase subunit Tim17 4(Tim17a2)

Recombinant Drosophila melanogaster Probable mitochondrial import inner membrane translocase subunit Tim17 4(Tim17a2)

SKU:CSB-CF893307DLU

Regular price $2,199.40 CAD
Regular price Sale price $2,199.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:Q9VN97

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEYNRQPCPIRIVEDCGCAFMMGTMGGSLFQYLKGFRNAPSGLRRGLHGGIESVRLRTPA IAGSFAIWGATFSTVDCVMVSYRQREDSWNAIVSGAATGGILAARNGIRAMANSAFVGCL VLAMLEGAGAAVATIYASDGGVKAEESLITVDQQMQRPQWETSVADSNLTGAELERVLDE CRAYRAHNKMQQPMRSDAVEGKELGQLMKPMHSLVDLVKLAEIV

Protein Names:Recommended name: Probable mitochondrial import inner membrane translocase subunit Tim17 4

Gene Names:Name:Tim17a2 ORF Names:CG14666

Expression Region:1-224

Sequence Info:full length protein

View full details