
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: Q9VJS7
Gene Names: pburs
Organism: Drosophila melanogaster (Fruit fly)
AA Sequence: LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR
Expression Region: 21-141aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 15.8 kDa
Alternative Name(s): Bursicon subunit beta
Relevance: Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk.
Reference: Drosophila molting neurohormone bursicon is a heterodimer and the natural agonist of the orphan receptor DLGR2.Mendive F.M., Van Loy T., Claeysen S., Poels J., Williamson M., Hauser F., Grimmelikhuijzen C.J.P., Vassart G., Vanden Broeck J.J.M.FEBS Lett. 579:2171-2176(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.