Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila melanogaster Gamma-secretase subunit pen-2(pen-2)

Recombinant Drosophila melanogaster Gamma-secretase subunit pen-2(pen-2)

SKU:CSB-CF774747DLU

Regular price $2,018.80 CAD
Regular price Sale price $2,018.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:Q86BE9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDISKAPNPRKLELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQSQIKRYVIYS AVGTLFWLIVLTAWIIIFQTNRTAWGATADYMSFIIPLGSA

Protein Names:Recommended name: Gamma-secretase subunit pen-2 Alternative name(s): Presenilin enhancer protein 2

Gene Names:Name:pen-2 ORF Names:CG33198

Expression Region:1-101

Sequence Info:full length protein

View full details