Gene Bio Systems
Recombinant Drosophila melanogaster Cytochrome b5(Cyt-b5)
Recombinant Drosophila melanogaster Cytochrome b5(Cyt-b5)
SKU:CSB-CF894179DLU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Drosophila melanogaster (Fruit fly)
Uniprot NO.:Q9V4N3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSSEETKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENF EDVGHSNDARDMMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLV ATLFYKFFFGGAKQ
Protein Names:Recommended name: Cytochrome b5 Short name= CYTB5
Gene Names:Name:Cyt-b5 ORF Names:CG2140
Expression Region:1-134
Sequence Info:full length protein
