Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila grimshawi Calcium channel flower(flower)

Recombinant Drosophila grimshawi Calcium channel flower(flower)

SKU:CSB-CF453792DLL

Regular price $2,158.80 CAD
Regular price Sale price $2,158.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi)

Uniprot NO.:B4J043

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFAEKITGLLARPNQDPAGGPEAPWYLKYGSRVLGIVAAFFAILFGLWNVLSIIGLSVS CLVAGIIQMLAGFVVMALEAPCCFVCIEQVGSVADKVDAKPMYFRAGLYCAMAVPPIFMC FGLASLFGSGLIFATGAVYGMMALGKKASATDMRAAAQQSGYGGNATTSTTNDRAGIVNN AQPFSFTGAVGTDSNV

Protein Names:Recommended name: Calcium channel flower

Gene Names:Name:flower ORF Names:GH14474

Expression Region:1-196

Sequence Info:full length protein

View full details