Skip to product information
1 of 1

Gene Bio Systems

Recombinant Donkey ATP synthase protein 8(MT-ATP8)

Recombinant Donkey ATP synthase protein 8(MT-ATP8)

SKU:CSB-CF015071DK

Regular price $1,968.40 CAD
Regular price Sale price $1,968.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Equus asinus (Donkey)

Uniprot NO.:P92479

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPQLDTSTWFINIVSMILTLFIVFQLKISKHSYPMHPEAKTTKMAKRLTPWESKWTKIYSPLSLPQQ

Protein Names:Recommended name: ATP synthase protein 8 Alternative name(s): A6L F-ATPase subunit 8

Gene Names:Name:MT-ATP8 Synonyms:ATP8, ATPASE8, MTATP8

Expression Region:1-67

Sequence Info:full length protein

View full details