Gene Bio Systems
Recombinant Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad-1(dad-1)
Recombinant Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad-1(dad-1)
SKU:CSB-CF347366CXY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis elegans
Uniprot NO.:P52872
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAAQVVPVLSKLFDDYQKTTSSKLKIIDAYMTYILFTGIFQFIYCLLVGTFPFNSFLSGF ISTVTSFVLASCLRMQVNQENRSEFTAVSTERAFADFIFANLILHLVVVNFLG
Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad-1 Short name= Oligosaccharyl transferase subunit dad-1 EC= 2.4.1.119 Alternative name(s): Defender against cell death 1 Short name= P
Gene Names:Name:dad-1 ORF Names:F57B10.10
Expression Region:1-113
Sequence Info:full length protein
