Gene Bio Systems
Recombinant Dog T-cell surface glycoprotein CD3 epsilon chain(CD3E)
Recombinant Dog T-cell surface glycoprotein CD3 epsilon chain(CD3E)
SKU:CSB-CF004931DO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Canis familiaris (Dog) (Canis lupus familiaris)
Uniprot NO.:P27597
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QDEDFKASDDLTSISPEKRFKVSISGTEVVVTCPDVFGYDNIKWEKNDNLVEGASNRELSQKEFSEVDDSGYYACYADSIKEKSYLYLRARVCANCIEVNLMAVVTIIVADICLTLGLLLMVYYWSKTRKANAKPVMRGTGAGSRPRGQNKEKPPPVPNPDYEPIRKGQQDLYSGLNQRGI
Protein Names:Recommended name: T-cell surface glycoprotein CD3 epsilon chain Alternative name(s): CD_antigen= CD3e
Gene Names:Name:CD3E
Expression Region:22-202
Sequence Info:full length protein
