Gene Bio Systems
Recombinant Dog Solute carrier family 2, facilitated glucose transporter member 4(SLC2A4)
Recombinant Dog Solute carrier family 2, facilitated glucose transporter member 4(SLC2A4)
SKU:CSB-CF895472DO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Canis familiaris (Dog) (Canis lupus familiaris)
Uniprot NO.:Q9XST2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TSIFETAGVGQPAYATIGAGVVNTVFTLVSVFLVERAGRRTLHLLGLAGMCGCAILMTIA LLLLERLPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFCNWTS NFIIGMGFQYIAXAMGPYVFLLFAVLLLAFFIFTFLKVPETR
Protein Names:Recommended name: Solute carrier family 2, facilitated glucose transporter member 4 Alternative name(s): Glucose transporter type 4, insulin-responsive Short name= GLUT-4
Gene Names:Name:SLC2A4 Synonyms:GLUT4 ORF Names:B146
Expression Region:1-162
Sequence Info:full length protein
