Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dog Prostaglandin E synthase(PTGES)

Recombinant Dog Prostaglandin E synthase(PTGES)

SKU:CSB-CF018976DO

Regular price $2,094.40 CAD
Regular price Sale price $2,094.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Canis familiaris (Dog) (Canis lupus familiaris)

Uniprot NO.:A0SYQ0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPPPVLALVSGQALPAFLLCSTLLVIKMYVVAVITGQVRLRKKAFANPEDALRHGGLQYC RSDQDVDRCLRAHRNDMETIYPFLFLGFVYSFLGPDPFIAQMHFLVFFLGRMVHTVAYLG KLRAPTRSLAYTVAQLPCASMALQIVWEAACHL

Protein Names:Recommended name: Prostaglandin E synthase EC= 5.3.99.3 Alternative name(s): Microsomal prostaglandin E synthase 1 Short name= MPGES-1

Gene Names:Name:PTGES Synonyms:PGES

Expression Region:1-153

Sequence Info:Full length protein

View full details