Gene Bio Systems
Recombinant Dog Myelin and lymphocyte protein(MAL)
Recombinant Dog Myelin and lymphocyte protein(MAL)
SKU:CSB-CF631707DO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Canis familiaris (Dog) (Canis lupus familiaris)
Uniprot NO.:Q28296
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAPAAASGGSSLPSGFSVFTTFPDLLFIFEFIFGGLVWILIASSLVPIPLVQGWVMFVSV FCFMATTALLVLYIIGAHGGENSWVTLDAAYHCIAALFYLSASVLEALATIGMQEGYTYK QYHENISAVVFSYVATLLYVVHAVFSLIRWKSS
Protein Names:Recommended name: Myelin and lymphocyte protein Alternative name(s): T-lymphocyte maturation-associated protein VIP17 proteolipid
Gene Names:Name:MAL
Expression Region:1-153
Sequence Info:full length protein
