Recombinant Dog Lutropin subunit beta(LHB)

SKU: CSB-EP012910DO-GB

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P18842

Gene Names: LHB

Organism: Canis lupus familiaris (Dog) (Canis familiaris)

AA Sequence: SRGPLRPLCRPINATLAAENEACPVCITFTTTICAGYCPSMVRVLPAALPPVPQPVCTYHELHFASIRLPGCPPGVDPMVSFPVALSCRCGPCRLSNSDCGGPRAQSLACDRPLLPGLLFL

Expression Region: 18-138aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 16.8 kDa

Alternative Name(s): Luteinizing hormone subunit beta Short name:LH-B Short name:LSH-B Short name:LSH-beta

Relevance: Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.

Reference: "Nucleic acid and amino acid sequences of dog beta LH: comparison to rat, cow and human beta LH."Wolf D.L., Appleby V.L., Hjerrild K., Baker A.R., Talmadge K.Nucleic Acids Res. 15:10602-10602(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.