Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dog Interleukin-8(IL8)

Recombinant Dog Interleukin-8(IL8)

SKU:CSB-YP011671DO

Regular price $1,637.40 CAD
Regular price Sale price $1,637.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P41324

Gene Names: IL8

Organism: Canis lupus familiaris (Dog) (Canis familiaris)

AA Sequence: AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP

Expression Region: 23-101aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 11.1 kDa

Alternative Name(s): C-X-C motif chemokine hemokine (C-X-C motif) ligand 8

Relevance: IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.

Reference: Cloning of a canine gene homologous to the human interleukin-8-encoding gene.Ishikawa J., Suzuki S., Hotta K., Hirota Y., Mizuno S., Suzuki K.Gene 131:305-306(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details