Gene Bio Systems
Recombinant Dinoroseobacter shibae Large-conductance mechanosensitive channel(mscL)
Recombinant Dinoroseobacter shibae Large-conductance mechanosensitive channel(mscL)
SKU:CSB-CF422839DIB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Dinoroseobacter shibae (strain DFL 12)
Uniprot NO.:A8LLI0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLNEFKQFIAKGNVMDMAVGIIIGAAFTAIVTSLVEDLINPIISLFTGGLDFSGLGLALT EGEEAAVFAYGNFIMAVINFLIIAWVVFLLVKMVNRIKEMAENEPEEAPAEDPGPTEKEL LMQIRDSLAKS
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:Dshi_0241
Expression Region:1-131
Sequence Info:full length protein
