Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum V-type proton ATPase proteolipid subunit(vatP)

Recombinant Dictyostelium discoideum V-type proton ATPase proteolipid subunit(vatP)

SKU:CSB-CF345411DKK

Regular price $2,158.80 CAD
Regular price Sale price $2,158.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:P54642

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFQLLSFLLSGEATAVERIITDACPVYAPFFGAMGVTAALVFTVMGAAYGTAKASVGISN MGVMKPDLVIKAFIPVIFAGVIAIYGLIICVILVGGIKPNANYTLMKSFTDLGAGLTVGL CGLAAGMAIGIVGDSGVRAFGQQPKLYVIMMLILIFSEALGLYGLIIGILLSSVSDTYCP GQALVPLNSGNVIGKN

Protein Names:Recommended name: V-type proton ATPase proteolipid subunit Short name= V-ATPase 16 kDa proteolipid subunit Alternative name(s): Vacuolar proton pump 16 kDa proteolipid subunit

Gene Names:Name:vatP ORF Names:DDB_G0274381

Expression Region:1-196

Sequence Info:full length protein

View full details