1 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Transmembrane protein 50 homolog(tmem50)

Recombinant Dictyostelium discoideum Transmembrane protein 50 homolog(tmem50)

CSB-CF684709DKK

$2,100.00 CAD
$2,100.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q54T60

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRKTIMKYLPALAGIIFTAGWFLWIDGHVYENTNNKNADFDGPHIQWIYYLPGIFATLGM VMANIVDLSALNSNSLLFDGGATKVRVWLFISFAISFGCIGAALWIMVAVFLPPHNTNDA AQWPGIAITLQTSLIFLSSLLLVFKKVRQDDEYDQF

Protein Names:Recommended name: Transmembrane protein 50 homolog

Gene Names:Name:tmem50 ORF Names:DDB_G0281983

Expression Region:1-156

Sequence Info:full length protein

View full details