Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Transmembrane and coiled-coil domain-containing protein 1 homolog(tmco1)

Recombinant Dictyostelium discoideum Transmembrane and coiled-coil domain-containing protein 1 homolog(tmco1)

SKU:CSB-CF681742DKK

Regular price $2,143.40 CAD
Regular price Sale price $2,143.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q54TU8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAALEVLFILFVSIASSLASEGVSWLLVYRTENYKRGKANIDRLQIQLDKLVDQESETSS LSKKGNKDKKIEKIEEQLKIANKELSFSKMKSMFAVAISMIALFSYLNRIFDGVVVCKLP FVPIGFLQGISHRTIAGDDYTDCSMTFIYAICSMFIRNNIQLILGTAPPKTKQANPWALP EEKKTR

Protein Names:Recommended name: Transmembrane and coiled-coil domain-containing protein 1 homolog

Gene Names:Name:tmco1 ORF Names:DDB_G0281489

Expression Region:1-186

Sequence Info:full length protein

View full details