Gene Bio Systems
Recombinant Dictyostelium discoideum Translocon-associated protein subunit gamma(ssr3)
Recombinant Dictyostelium discoideum Translocon-associated protein subunit gamma(ssr3)
SKU:CSB-CF687912DKK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Dictyostelium discoideum (Slime mold)
Uniprot NO.:Q55GT5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAEVDEFSAFRHENDVSIEQRIVYFINSLIVALVPVYLYHAIFFMSIDDHMIIYGSVTLF AAIVLTFAYNNIYRMKRLKLSASREHISIASKNKVGDKKKFAAAQKEVQALVTSHEAIAA SIMYNNAVFLICVSIFSFIIFKNVPLVYNYIISISLGAGLTSFLSTSSKH
Protein Names:Recommended name: Translocon-associated protein subunit gamma Short name= TRAP-gamma Alternative name(s): Signal sequence receptor subunit gamma Short name= SSR-gamma
Gene Names:Name:ssr3 ORF Names:DDB_G0267524
Expression Region:1-170
Sequence Info:full length protein
