Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Signal peptidase complex subunit 3(spcs3)

Recombinant Dictyostelium discoideum Signal peptidase complex subunit 3(spcs3)

SKU:CSB-CF022517DKK

Regular price $2,119.60 CAD
Regular price Sale price $2,119.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:B0G180

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHSLSQRANTIVCFGGIVLVGVLLLNVLSRAFFSDHVDVDIKLNEIHRFNTQRNFEYSFISIDLDANLEPLFNWNTKMLFLYVTAEYRTKQNVLSQVVVWDHILTEKSKANIHEKRLSKYPIINQGLGLKNNTIKLTFNYNVVPISGILTRHQVGTSEFKFPTTYMKEAY

Protein Names:Recommended name: Signal peptidase complex subunit 3 EC= 3.4.-.-

Gene Names:Name:spcs3 Synonyms:spc3 ORF Names:DDB_G0290851

Expression Region:1-170

Sequence Info:full length protein

View full details