Recombinant Dictyostelium discoideum  Putative uncharacterized transmembrane protein DDB_G0287865(DDB_G0287865)

Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0287865(DDB_G0287865)

CSB-CF687615DKK
Regular price
$1,400.00 CAD
Sale price
$1,400.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q54JQ0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQEEKNKEILLKDIENQIPYSKPFGVYDQLKKRIFRFILGVILLGVIIESITLLVVYFKD KK

Protein Names:Recommended name: Putative uncharacterized transmembrane protein DDB_G0287865

Gene Names:ORF Names:DDB_G0287865

Expression Region:1-62

Sequence Info:full length protein

Your list is ready to share