Gene Bio Systems
Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0272506(DDB_G0272506)
Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0272506(DDB_G0272506)
SKU:CSB-CF755481DKK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Dictyostelium discoideum (Slime mold)
Uniprot NO.:Q7KWU5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKDYEIVFTVFSSIIFAFLLFRLCKFCCVFCCALCNVPDNVYGRKRPRGSIVVEENEDDG NGEKEGLLNV
Protein Names:Recommended name: Putative uncharacterized protein DDB_G0272506
Gene Names:ORF Names:DDB_G0272506
Expression Region:1-70
Sequence Info:full length protein
