Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Putative elongation of fatty acids protein DDB_G0274669(DDB_G0274669)

Recombinant Dictyostelium discoideum Putative elongation of fatty acids protein DDB_G0274669(DDB_G0274669)

SKU:CSB-CF700979DKK

Regular price $2,240.00 CAD
Regular price Sale price $2,240.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q555E8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:METVQSIITEWTDPKSWEKLVQHSFKDSNWKELIDPVNYKFNFGVTPFSQFQIIPIVLVI YLVTIFSIKFLMKNRKPFSLKFISILHNAILCIWSLIMCVGVLYEIIKRVSNEGPLFTVC EDPNGGFDKGVTYYWSYIFYISKFYELLDTVIIVLKKKPLIFLHVYHHCKTVWWKKYITM IQILQFVCLGIAGVLHVYTINTIGCFTHYPAFAAAYSINFSFLFLFSKFFVKSYTPKNSN SNTNIKSKKID

Protein Names:Recommended name: Putative elongation of fatty acids protein DDB_G0274669 EC= 2.3.1.n8 Alternative name(s): 3-keto acyl-CoA synthase DDB_G0274669

Gene Names:ORF Names:DDB_G0274669

Expression Region:1-251

Sequence Info:full length protein

View full details