Gene Bio Systems
Recombinant Dictyostelium discoideum Ponticulin(ponA)
Recombinant Dictyostelium discoideum Ponticulin(ponA)
SKU:CSB-YP345793DKK
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P54660
Gene Names: ponA
Organism: Dictyostelium discoideum (Slime mold)
AA Sequence: QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS
Expression Region: 23-118aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 11.9 kDa
Alternative Name(s):
Relevance: Binds F-actin and nucleates actin assembly. Major high affinity link between the plasma membrane and the cortical actin network.
Reference: "F-actin affinity chromatography of detergent-solubilized plasma membranes: purification and initial characterization of ponticulin from Dictyostelium discoideum."Wuestehube L.J., Speicher D.W., Shariff A., Luna E.J.Methods Enzymol. 196:47-65(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
