Recombinant Dictyostelium discoideum Ponticulin(ponA)

SKU: CSB-EP345793DKK

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Microbiology

Uniprot ID: P54660

Gene Names: ponA

Organism: Dictyostelium discoideum (Slime mold)

AA Sequence: QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS

Expression Region: 23-118aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 13.9 kDa

Alternative Name(s):

Relevance: Binds F-actin and nucleates actin assembly. Major high affinity link between the plasma membrane and the cortical actin network.

Reference: "Identification of a second member of the ponticulin gene family and its differential expression pattern."Hitt A.L., Iijima-Shimizu M., DuBay M.J., Antonette L.L., Urushihara H., Wilkerson C.G.Biochim. Biophys. Acta 1628:79-87(2003).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.