Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Mitochondrial substrate carrier family protein G(mcfG)

Recombinant Dictyostelium discoideum Mitochondrial substrate carrier family protein G(mcfG)

SKU:CSB-CF690505DKK

Regular price $2,312.80 CAD
Regular price Sale price $2,312.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q54BM3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASNNKDSQLMIALKDIVAGSIGGVGQVFTGHPLDTIKVRLQTQSVGNPIYSGTMDCLKK TISQEGFAGLYKGVASPLVGLSIMNSVMFLAYGQSKTLIQKLSDNPNEALDLKGLTAAGA LAGIAIGFVDAPVDLFKSQMQVQQGDKNQYKSTADCAKQIWKVGGVRGVFQGLGATLVRD IPANACYFGAYELCRDFLASKDNISVNQLSSLQIMAAGGAGGVSYWTLTYPADVVKSTMQ TDAIVKSQRKYKNMIDCASKIYKQQGIAGFYKGFTPCFIRSVPANAACFVLYEKARQIMS

Protein Names:Recommended name: Mitochondrial substrate carrier family protein G Alternative name(s): Solute carrier family 25 member 20 homolog A

Gene Names:Name:mcfG Synonyms:slc25a20A ORF Names:DDB_G0293556

Expression Region:1-300

Sequence Info:full length protein

View full details