Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Elongation of fatty acids protein A(eloA)

Recombinant Dictyostelium discoideum Elongation of fatty acids protein A(eloA)

SKU:CSB-CF709643DKK

Regular price $2,269.40 CAD
Regular price Sale price $2,269.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q54CJ4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEHIHDINFQEFSKDPIGTIDRFRWKNEVTPFSNILFPIVCSFGYLALIYGLQIFMKNKK EIKLHGFAMFHNLFLCLLSLLMFLGIVIPMAKYSFPHGLYNIICKPIDSGLVQFSYYIFY LSKVYEFIDTIIQVLRKKSLLFLHVWHHFITLWLVWANLKYDTGCQWVDISANCFVHIVM YFYYFQTERGINPWWKKHITTCQIIQFIVDMSSHLAWHFYDTQGNHNSNYCSGTWATSAF SDFVILSFLGLFIQFFVKAYKKKSSIKKKTN

Protein Names:Recommended name: Elongation of fatty acids protein A EC= 2.3.1.n8 Alternative name(s): 3-keto acyl-CoA synthase eloA Fatty acid elongase A

Gene Names:Name:eloA ORF Names:DDB_G0292896

Expression Region:1-271

Sequence Info:full length protein

View full details