Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Cytochrome c1, heme protein, mitochondrial(cyc1)

Recombinant Dictyostelium discoideum Cytochrome c1, heme protein, mitochondrial(cyc1)

SKU:CSB-CF706679DKK

Regular price $2,234.40 CAD
Regular price Sale price $2,234.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q54D07

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ITTSTTLLSDDFVQPTSYPWEHRFPWQSYDHAAIRRGHQVYTQVCSTCHSLNLISYRHLA NVAYTPEELKAMAADTTVMDGPDSEGDMFERKGQVTDFHPKPYPNSNAARFANNGALPPD LSLVIKARGAHEDYVFSLLTGYCEPPAGVRVVGGQYFNPYFPGTKIAMAPPLADGMVEYD DGTDNSMSQMAKDVSTFLCWASEPEHDDRKKLGMKVLLGVSIIALPLFYWKRLKWSVIKT RKISFKD

Protein Names:Recommended name: Cytochrome c1, heme protein, mitochondrial Short name= Cytochrome c-1 Alternative name(s): Complex III subunit 4 Complex III subunit IV Cytochrome b-c1 complex subunit 4

Gene Names:Name:cyc1 ORF Names:DDB_G0292594

Expression Region:29-275

Sequence Info:full length protein

View full details