1 1

Gene Bio Systems

Recombinant Dictyostelium discoideum ATP synthase subunit 9, mitochondrial(atp9)

Recombinant Dictyostelium discoideum ATP synthase subunit 9, mitochondrial(atp9)

CSB-CF657092DKK

$1,999.20 CAD
$1,999.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q37315

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20ā„ƒ, for extended storage, conserve at -20ā„ƒ or -80ā„ƒ.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā„ƒ for up to one week.

AA Sequence:MKNIVKIEQLELASAVVELGKKVGAGLAAIGLTGAGAGVGIVFAAFILAVGMNPNLRGEL FKLAMLGFALSEAVGLLALMMSFLILYS

Protein Names:Recommended name: ATP synthase subunit 9, mitochondrial Alternative name(s): Lipid-binding protein

Gene Names:Name:atp9 ORF Names:DDB_G0294016

Expression Region:1-88

Sequence Info:full length protein

View full details