Gene Bio Systems
Recombinant Dickeya dadantii L-alanine exporter AlaE(alaE)
Recombinant Dickeya dadantii L-alanine exporter AlaE(alaE)
SKU:CSB-CF512981DKF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Dickeya dadantii (strain Ech703)
Uniprot NO.:C6C9J7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPPLLYRLRSVLADTVAMVIYCFITGMAVEMLLSEMTFQQSLSSRLLSIPVNIVIAWPYG LYRDRIVALLLKWGKNKHGIRNLADLFAYVSFQSPVYAAILWAIGADLSQIVRAVGSNAI ISMLMGVVYGYFLEYCRHLFRVPVLNRQRIGSN
Protein Names:Recommended name: L-alanine exporter AlaE
Gene Names:Name:alaE Ordered Locus Names:Dd703_0637
Expression Region:1-153
Sequence Info:full length protein
