Skip to product information
1 of 1

Gene Bio Systems

Recombinant Desulfovibrio vulgaris subsp. vulgaris UPF0059 membrane protein Dvul_0455 (Dvul_0455)

Recombinant Desulfovibrio vulgaris subsp. vulgaris UPF0059 membrane protein Dvul_0455 (Dvul_0455)

SKU:CSB-CF380168DHY

Regular price $2,165.80 CAD
Regular price Sale price $2,165.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

Uniprot NO.:A1VAL2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNTLECLAVAVALAMDAFAVAIATGIRLREVSPRQTFRLAFHFGLFQALMPVAGWTLGLT VRGYIEQWDHWLAFGLLLYIGVRMMREAFEETEENDDRCDPTRGLTLIMLAVATSIDALA VGLSLSVLGIDIVTPAIVIGVVCLLFTATGLHLGRMLSRAESLGRRAALAGGVVLIGIGL RILYEHGVFDTAATLARSVLG

Protein Names:Recommended name: UPF0059 membrane protein Dvul_0455

Gene Names:Ordered Locus Names:Dvul_0455

Expression Region:1-201

Sequence Info:full length protein

View full details