Skip to product information
1 of 1

Gene Bio Systems

Recombinant Desulfovibrio salexigens UPF0059 membrane protein Desal_2561 (Desal_2561)

Recombinant Desulfovibrio salexigens UPF0059 membrane protein Desal_2561 (Desal_2561)

SKU:CSB-CF511153DJQ

Regular price $2,142.00 CAD
Regular price Sale price $2,142.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763)

Uniprot NO.:C6BYL0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPFYEIFIISVALAMDAFTIAVACGLCMPEVSKRQNFRLSFHFGLFQALMPLLGWLAGLT VKSMVETYAPWISFFLLAFVGGKMIQESFETDDSCDTYKDPTKGLSLVFLSVATSLDALA VGLSFSIMDYPIAFPCVMIGITALVLTSFGLWLGKSFAKASSYSHIAERIGGVVLILIGL KLLLQ

Protein Names:Recommended name: UPF0059 membrane protein Desal_2561

Gene Names:Ordered Locus Names:Desal_2561

Expression Region:1-185

Sequence Info:full length protein

View full details