Gene Bio Systems
Recombinant Desulfotomaculum reducens UPF0059 membrane protein Dred_3165 (Dred_3165)
Recombinant Desulfotomaculum reducens UPF0059 membrane protein Dred_3165 (Dred_3165)
SKU:CSB-CF393114DHX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Desulfotomaculum reducens (strain MI-1)
Uniprot NO.:A4J9B4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLFTLFALAVALGTDAFSLCIGIGIAGVNRRQIALISLTVLIFHILMPLLGWYAGGFLG SKMGQAASIAGALLLLYLGGKMIWDTIKPGKDEGPRFVITNTGGLLLLSASVSMDALSVG FTLGTQQVSLVLAAGVIGLVAGMMTFAGLTLGKYVGDWIGERAELVGGIILVGIGVKLFF
Protein Names:Recommended name: UPF0059 membrane protein Dred_3165
Gene Names:Ordered Locus Names:Dred_3165
Expression Region:1-180
Sequence Info:full length protein
