Skip to product information
1 of 1

Gene Bio Systems

Recombinant Desulforudis audaxviator UPF0059 membrane protein Daud_2150 (Daud_2150)

Recombinant Desulforudis audaxviator UPF0059 membrane protein Daud_2150 (Daud_2150)

SKU:CSB-CF534172DJM

Regular price $2,135.00 CAD
Regular price Sale price $2,135.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Desulforudis audaxviator (strain MP104C)

Uniprot NO.:B1I6K8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTAGTVLLLAGALGTDAFSLCLGLGLNGFRRRMAWMLVGLIVALHVVLPVAGWYAGEFTG RLVGRWAAYLGAAILFYLGVKMVRESLAEGRTATGKLERAGFLGLTVLAGSVSMDALSVG FTLGTAGAALLLTAGVIGLVAGLMSAAAFVLAHRVEDWVGRRAELLGGLVLIGVGLRLLF

Protein Names:Recommended name: UPF0059 membrane protein Daud_2150

Gene Names:Ordered Locus Names:Daud_2150

Expression Region:1-180

Sequence Info:full length protein

View full details