Skip to product information
1 of 1

Gene Bio Systems

Recombinant Desulfitobacterium hafniense UPF0059 membrane protein DSY1211(DSY1211)

Recombinant Desulfitobacterium hafniense UPF0059 membrane protein DSY1211(DSY1211)

SKU:CSB-CF638808DAAE

Regular price $2,146.20 CAD
Regular price Sale price $2,146.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Desulfitobacterium hafniense (strain Y51)

Uniprot NO.:Q24Y92

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIMGNLELFLIAVGLSMDAFAVAISKGLSMRRMSYKTALITGLFFGGFQALMPLIGFLLG TRFESYITAIDHWIAFILLSLIGLNMIKESRGPCEIIEDRFNLKDMIILSLATSIDALAV GITFAFLHVDIVPAVSMIGVTTFLFSFLGVKIGNVFGECYKARAELAGGVILILMGLKIL LEHLGFLG

Protein Names:Recommended name: UPF0059 membrane protein DSY1211

Gene Names:Ordered Locus Names:DSY1211

Expression Region:1-188

Sequence Info:full length protein

View full details