Skip to product information
1 of 1

Gene Bio Systems

Recombinant Desulfitobacterium hafniense Protein CrcB homolog 1(crcB1)

Recombinant Desulfitobacterium hafniense Protein CrcB homolog 1(crcB1)

SKU:CSB-CF636592DAAE

Regular price $2,037.00 CAD
Regular price Sale price $2,037.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Desulfitobacterium hafniense (strain Y51)

Uniprot NO.:Q24VQ6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFGAMLRYLIGISFFADSRFPWATLTINLLGSFLLAWLTSYVFKKVRLSPHLSTAIGTGF VGSFTTFSTLSVETISLFQDGHNFLAMVYVLVSLLGGLTMSHLGFKVSKEVQKS

Protein Names:Recommended name: Protein CrcB homolog 1

Gene Names:Name:crcB1 Ordered Locus Names:DSY2097

Expression Region:1-114

Sequence Info:full length protein

View full details