Recombinant Dermatophagoides pteronyssinus Major mite allergen Der p 23

SKU: L7N6F8

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: L7N6F8

Gene Names: N/A

Alternative Name(s): Major house dust mite allergen Der p 23 （Major HDM allergen Der p 23） (Peritrophin-like protein Der p 23)

Abbreviation: Recombinant Dermatophagoides pteronyssinus Major mite allergen Der p 23 protein

Organism: Dermatophagoides pteronyssinus (European house dust mite)

Source: E.coli

Expression Region: 22-90aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: ANDNDDDPTTTVHPTTTEQPDDKFECPSRFGYFADPKDPHKFYICSNWEAVHKDCPGNTRWNEDEETCT

MW: 10.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Does not bind chitin in vitro.

Reference: "Identification of Der p 23, a Peritrophin-like Protein, as a New Major Dermatophagoides pteronyssinus Allergen Associated with the Peritrophic Matrix of Mite Fecal Pellets." Weghofer M., Grote M., Resch Y., Casset A., Kneidinger M., Kopec J., Thomas W.R., Fernandez-Caldas E., Kabesch M., Ferrara R., Mari A., Purohit A., Pauli G., Horak F., Keller W., Valent P., Valenta R., Vrtala S. J. Immunol. 190: 3059-3067(2013)

Function: