Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dense granule protein 3(GRA3)

Recombinant Dense granule protein 3(GRA3)

SKU:CSB-CF467284TOV

Regular price $2,196.60 CAD
Regular price Sale price $2,196.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Toxoplasma gondii

Uniprot NO.:B6KEU8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDRTICPFFIQSFTMSTALKRLIPFLVPFVVFLVAAALGGLAADQPGNHQALAEPVTGVG EAGVSPVNEAGESYSSATSGVQEATAPGAVLLEAIDAESDKVDNQAEGGERMKKVEEELS LLRRELYDRTDRPGLKRAVILSLGTSALIAGRMFSSTLRAAVPWYAVAFNAIVAAYYIRK VLTYRRRVMTKRQPFMSSVKNFFRRRPKDGGAGVDKASKKQT

Protein Names:Recommended name: Dense granule protein 3 Alternative name(s): P30

Gene Names:Name:GRA3 Synonyms:Tg556 ORF Names:TGGT1_082670, TGME49_027280, TGVEG_068180

Expression Region:1-222

Sequence Info:full length protein

View full details