Skip to product information
1 of 1

Gene Bio Systems

Recombinant Deinococcus radiodurans Sulfoxide reductase heme-binding subunit YedZ(yedZ)

Recombinant Deinococcus radiodurans Sulfoxide reductase heme-binding subunit YedZ(yedZ)

SKU:CSB-CF870906DJA

Regular price $2,167.20 CAD
Regular price Sale price $2,167.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

Uniprot NO.:Q9RRF5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MARRPPPYAWLGPGVVLGGLLPTVFLLWDALSGGLGANPVKQATHQTGQLALIVLTLSLA CTPARVWLGWTWAARIRKALGLLAAFYAVLHFGIYLRGQDFSLGRIWEDVTERPFITSGF AALLLLLPLVLTSGKGSVRRLGFARWTLLHRLVYLAAALGALHYWWGVKKDHSGPLLAVL VLAALGLARLKTPARLNRPARQ

Protein Names:Recommended name: Sulfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ

Gene Names:Name:yedZ Ordered Locus Names:DR_2537

Expression Region:1-202

Sequence Info:full length protein

View full details