Skip to product information
1 of 1

Gene Bio Systems

Recombinant Debaryomyces hansenii Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)

Recombinant Debaryomyces hansenii Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)

SKU:CSB-CF738253DIS

Regular price $1,983.80 CAD
Regular price Sale price $1,983.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Uniprot NO.:Q6BXM0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPADIPKSVVQKLVFFTAAMIICPVATFFICQYLFSNNAIISGGVSALVANIVLIGYVVA AFMEDTTEQEPEETKKSR

Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21

Gene Names:Name:VMA21 Ordered Locus Names:DEHA2B01892g

Expression Region:1-78

Sequence Info:full length protein

View full details