Gene Bio Systems
Recombinant Debaryomyces hansenii Mitochondrial intermembrane space import and assembly protein 40(MIA40)
Recombinant Debaryomyces hansenii Mitochondrial intermembrane space import and assembly protein 40(MIA40)
SKU:CSB-CF731913DIS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Uniprot NO.:Q6BSK8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SNQGFRAAKASKTNMYLGAGIALIPVIMSINYLNGNHIANEVDENKVEEGKKKAESTGKK EFVEKAEKEAIGKADVKTKVPAEEANPETRTETDKPSEESQKDEENSYEGAAYNPETGEI NWDCPCLGGMAHGPCGEEFKEAFACFIYSESEPKGIECIKKFESMRNCFREHPEHYKEEL YDDEEQEPLVDVNEKKGDASEQSAETIADDATKVVKEKAKAEDSNTK
Protein Names:Recommended name: Mitochondrial intermembrane space import and assembly protein 40 Alternative name(s): Mitochondrial import inner membrane translocase TIM40
Gene Names:Name:MIA40 Synonyms:TIM40 Ordered Locus Names:DEHA2D08096g
Expression Region:23-249
Sequence Info:full length protein
