Recombinant Debaryomyces hansenii  Golgi to ER traffic protein 1(GET1)

Recombinant Debaryomyces hansenii Golgi to ER traffic protein 1(GET1)

CSB-CF738258DIS
Regular price
$1,563.00 CAD
Sale price
$1,563.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Uniprot NO.:Q6BYU3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFDISSSNLLISVLVVLFAKQLINAVGKATLENIGWSAYCKVAPKLGDSKFIALDQKNVE LAKVSKERKSISAQDQYARWTKLNRQFDKLTGEINKLKEETSASRSYISKYIGYMILVTT TLPIWFFRVWFRKAVLFYFPTGVLPHYLEWFLALPFITTGGVGLTIWMSAVNNVVSSVIF LVKFPFEKEVPFPSKEVGNEKTSINKEEVSGTPAAN

Protein Names:Recommended name: Golgi to ER traffic protein 1 Alternative name(s): Guided entry of tail-anchored proteins 1

Gene Names:Name:GET1 Ordered Locus Names:DEHA2A06930g

Expression Region:1-216

Sequence Info:full length protein

Your list is ready to share