Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio UPF0510 protein INM02 (zgc:171980)

Recombinant Danio rerio UPF0510 protein INM02 (zgc:171980)

SKU:CSB-CF003478DIL

Regular price $2,209.20 CAD
Regular price Sale price $2,209.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:A7E2M3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:NNGRRSGDAVDTDFSGFSVPLEHSFEVDDVPRFRLRGALQFRGGRENSVYLSQNQLSEKDRNTLKDVAAVDGLYRIRVPRVSLQVDRQTERQYEGYLTAFVRACALVESHLSDVITLHTDVSGYVIGISIVTIPGSCRGIEVEDEVDLEVFNTTISVMAPVTAPVPETAPYIERMEMEMEKKGKNPQEQKSFFAKYWMYIVPLVLFLMMSGAQDQSGGGAGGGAANGGGR

Protein Names:Recommended name: UPF0510 protein INM02

Gene Names:ORF Names:zgc:171980

Expression Region:28-257

Sequence Info:full length protein

View full details