Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: Q4W898
Gene Names: tnfb
Organism: Danio rerio (Zebrafish) (Brachydanio rerio)
AA Sequence: AIHLHGDPSGQSLKWVGGVDQAFQQGGLRLENNEIIIPKDGLYFVYSQVSYETLCVEDVEGDGQKYLSHTINRYTDAVREKMPLQNSANSVCQSLDGKTSYSTIYLGAVFDLFGDDRLSTHTTRVGDIENNYAKTFFGVFAL
Expression Region: 101-242aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 19.8 kDa
Alternative Name(s): tnf TNF alpha
Relevance:
Reference: "Mmp23b promotes liver development and hepatocyte proliferation through the tumor necrosis factor pathway in zebrafish." Qi F., Song J., Yang H., Gao W., Liu N.A., Zhang B., Lin S. Hepatology 52:2158-2166(2010)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.