Recombinant Danio rerio Tumor necrosis factor(TNF superfamily, member 2)(tnfb),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Danio rerio Tumor necrosis factor(TNF superfamily, member 2)(tnfb),partial

CSB-EP2355DIL1
Regular price
$886.25 CAD
Sale price
$886.25 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: tnfb

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Danio rerio (Zebrafish) (Brachydanio rerio)

Delivery time: 3-7 business days

Uniprot ID: Q4W898

AA Sequence: AIHLHGDPSGQSLKWVGGVDQAFQQGGLRLENNEIIIPKDGLYFVYSQVSYETLCVEDVEGDGQKYLSHTINRYTDAVREKMPLQNSANSVCQSLDGKTSYSTIYLGAVFDLFGDDRLSTHTTRVGDIENNYAKTFFGVFAL

Tag info: N-terminal 6xHis-tagged

Expression Region: 101-242aa

Protein length: Partial

MW: 19.8 kDa

Alternative Name(s): tnf TNF alpha

Relevance:

Reference: "Mmp23b promotes liver development and hepatocyte proliferation through the tumor necrosis factor pathway in zebrafish." Qi F., Song J., Yang H., Gao W., Liu N.A., Zhang B., Lin S. Hepatology 52:2158-2166(2010)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share