Gene Bio Systems
Recombinant Danio rerio Superoxide dismutase [Cu-Zn] (sod1)
Recombinant Danio rerio Superoxide dismutase [Cu-Zn] (sod1)
SKU:CSB-EP022397DIL
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Signal Transduction
Target / Protein: sod1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Danio rerio (Zebrafish) (Brachydanio rerio)
Delivery time: 3-7 business days
Uniprot ID: O73872
AA Sequence: MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 1-154aa
Protein length: Full Length
MW: 37.1 kDa
Alternative Name(s):
Relevance: Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
Reference: "Comparative effects of dietary methylmercury on gene expression in liver, skeletal muscle, and brain of the zebrafish (Danio rerio)." Gonzalez P., Dominique Y., Massabuau J.C., Boudou A., Bourdineaud J.P. Environ. Sci. Technol. 39:3972-3980(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
![Recombinant Danio rerio Superoxide dismutase [Cu-Zn] (sod1)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_a2cc7b6a-5e20-4826-8403-24e2d4021cbc.jpg?v=1659192507&width=1445)